Anti-C Reactive Protein

Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
ARG40847.50 50 µg - -

6 - 14 Werktage*

520,00 €
 
Protein function: Displays several functions associated with host defense: it promotes... mehr
Produktinformationen "Anti-C Reactive Protein"
Protein function: Displays several functions associated with host defense: it promotes agglutination, bacterial capsular swelling, phagocytosis and complement fixation through its calcium-dependent binding to phosphorylcholine. Can interact with DNA and histones and may scavenge nuclear material released from damaged circulating cells. [The UniProt Consortium]
Schlagworte: Anti-CRP, Anti-PTX1
Hersteller: Arigo Biolaboratories
Hersteller-Nr: ARG40847

Eigenschaften

Anwendung: IHC (paraffin), WB
Antikörper-Typ: Polyclonal
Konjugat: No
Wirt: Rabbit
Spezies-Reaktivität: human, mouse
Immunogen: Synthetic peptide corresponding to a sequence of Human CRP. (QTDMSRKAFVFPKESDTSYVSLKAPLTKPLKA)
MW: 25 kD

Handhabung & Sicherheit

Lagerung: -20°C
Versand: +4°C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-C Reactive Protein"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen