Anti-Bmi1

Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
ARG58309.50 50 µg - -

6 - 14 Werktage*

551,00 €
 
Protein function: Component of a Polycomb group (PcG) multiprotein PRC1- like complex, a complex... mehr
Produktinformationen "Anti-Bmi1"
Protein function: Component of a Polycomb group (PcG) multiprotein PRC1- like complex, a complex class required to maintain the transcriptionally repressive state of many genes, including Hox genes, throughout development. PcG PRC1 complex acts via chromatin remodeling and modification of histones, it mediates monoubiquitination of histone H2A 'Lys-119', rendering chromatin heritably changed in its expressibility (PubMed:15386022, PubMed:16359901, PubMed:26151332, PubMed:16714294, PubMed:21772249, PubMed:25355358, PubMed:27827373). The complex composed of RNF2, UB2D3 and BMI1 binds nucleosomes, and has activity only with nucleosomal histone H2A (PubMed:21772249, PubMed:25355358). In the PRC1-like complex, regulates the E3 ubiquitin-protein ligase activity of RNF2/RING2 (PubMed:15386022, PubMed:26151332, PubMed:21772249). [The UniProt Consortium]
Schlagworte: Anti-BMI1, Anti-PCGF4, Anti-RING finger protein 51, Anti-Polycomb complex protein BMI-1, Anti-Polycomb group RING finger protein 4
Hersteller: Arigo Biolaboratories
Hersteller-Nr: ARG58309

Eigenschaften

Anwendung: WB
Antikörper-Typ: Polyclonal
Konjugat: No
Wirt: Rabbit
Spezies-Reaktivität: human, mouse, rat (Erwartet: bovine)
Immunogen: Synthetic peptide corresponding to a sequence in the middle region of Human Bmi1(135-165aa IEFFDQNRLDRKVNKDKEKSKEEVNDKRYLR), different from the related Mouse sequence by four amino acids
MW: 37 kD
Format: Antigen Affinity Purified

Handhabung & Sicherheit

Lagerung: -20°C
Versand: +4°C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-Bmi1"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen