Anti-Angiotensin-converting enzyme (Ace)

Anti-Angiotensin-converting enzyme (Ace)
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
NSJ-RQ4007 100 µg - -

3 - 10 Werktage*

755,00 €
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Angiotensin I converting enzyme (ACE),... mehr
Produktinformationen "Anti-Angiotensin-converting enzyme (Ace)"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Angiotensin I converting enzyme (ACE), also called DCP or CD143 is a zinc-containing dipeptidyl carboxypeptidase widely distributed in mammalian tissues and is thought to play a critical role in blood pressure regulation. This gene is mapped to 17q23.3. This gene encodes an enzyme involved in catalyzing the conversion of angiotensin I into a physiologically active peptide angiotensin II. Angiotensin II is a potent vasopressor and aldosterone-stimulating peptide that controls blood pressure and fluid-electrolyte balance. This enzyme plays a key role in the renin-angiotensin system. Many studies have associated the presence or absence of a 287 bp Alu repeat element in this gene with the levels of circulating enzyme or cardiovascular pathophysiologies. Protein function: Converts angiotensin I to angiotensin II by release of the terminal His-Leu, this results in an increase of the vasoconstrictor activity of angiotensin. Also able to inactivate bradykinin, a potent vasodilator. Has also a glycosidase activity which releases GPI-anchored proteins from the membrane by cleaving the mannose linkage in the GPI moiety. This GPIase activity seems to be crucial for the egg-binding ability of the sperm. [The UniProt Consortium]
Schlagworte: Anti-Ace, Anti-Dcp1, EC=3.2.1.-, EC=3.4.15.1, Angiotensin-converting enzyme Antibody (Ace)
Hersteller: NSJ Bioreagents
Hersteller-Nr: RQ4007

Eigenschaften

Anwendung: WB
Antikörper-Typ: Polyclonal
Konjugat: No
Wirt: Rabbit
Spezies-Reaktivität: mouse, rat
Immunogen: Amino acids AMMNYFKPLTEWLVTENRRHGETLGWPEYNWAPNTAR from the mouse protein were used as the immunogen for the Ace antibody.
Format: Purified

Handhabung & Sicherheit

Lagerung: +4°C
Versand: +4°C (International: +4°C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-Angiotensin-converting enzyme (Ace)"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen