Anti-AMH, clone 5/6

Anti-AMH, clone 5/6
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
ARG22461.250 250 µl - -

6 - 14 Werktage*

576,00 €
 
Protein function: This glycoprotein, produced by the Sertoli cells of the testis, causes... mehr
Produktinformationen "Anti-AMH, clone 5/6"
Protein function: This glycoprotein, produced by the Sertoli cells of the testis, causes regression of the Muellerian duct. It is also able to inhibit the growth of tumors derived from tissues of Muellerian duct origin. [The UniProt Consortium]
Schlagworte: Anti-AMH, Anti-MIF, Anti-MIS, Anti-Anti-Muellerian hormone, Anti-Muellerian-inhibiting factor, Anti-Muellerian-inhibiting substance
Hersteller: Arigo Biolaboratories
Hersteller-Nr: ARG22461

Eigenschaften

Anwendung: IHC (paraffin), WB
Antikörper-Typ: Monoclonal
Klon: 5/6
Konjugat: No
Wirt: Mouse
Spezies-Reaktivität: human, mouse, sheep, monkey, baboon
Immunogen: Synthetic peptide derived from human AMH (VPTAYAGKLLISLSEERISAHHVPNMVATEC)
Format: Purified

Handhabung & Sicherheit

Lagerung: -20°C
Versand: +4°C (International: +4°C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-AMH, clone 5/6"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen