Anti-Alpha Amylase 1

Anti-Alpha Amylase 1
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
NSJ-R32663 100 µg - -

3 - 10 Werktage*

755,00 €
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Amylase is an enzyme that catalyses the... mehr
Produktinformationen "Anti-Alpha Amylase 1"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Amylase is an enzyme that catalyses the breakdown of starch into sugars. Amylase is present in human saliva, where it begins the chemical process of digestion. By in situ hybridization combined with high resolution cytogenetics, the amylase gene is mapped to 1p21. Amylase enzymes find use in bread making and to break down complex sugars such as starch (found in flour) into simple sugars. Yeast then feeds on these simple sugars and converts it into the waste products of alcohol and CO2.
Schlagworte: Anti-AMY1, Anti-AMY1A, Anti-AMY1B, Anti-AMY1C, Anti-Alpha-amylase 1, Anti-Salivary alpha-amylase, Anti-1,4-alpha-D-glucan glucanohydrolase 1, Alpha Amylase 1 Antibody
Hersteller: NSJ Bioreagents
Hersteller-Nr: R32663

Eigenschaften

Anwendung: WB, IHC (paraffin)
Antikörper-Typ: Polyclonal
Konjugat: No
Wirt: Rabbit
Spezies-Reaktivität: human, mouse, rat
Immunogen: Amino acids 20-50 (NTQQGRTSIVHLFEWRWVDIALECERYLAPK) from the human protein
Format: Purified

Handhabung & Sicherheit

Lagerung: +4°C
Versand: +4°C (International: +4°C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-Alpha Amylase 1"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen