Anti-ALDH2, clone 5G7

Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
NSJ-RQ5544 100 µg - -

3 - 10 Werktage*

755,00 €
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. ALDH2 (Aldehyde Dehydrogenase 2 Family) is... mehr
Produktinformationen "Anti-ALDH2, clone 5G7"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. ALDH2 (Aldehyde Dehydrogenase 2 Family) is a human gene. The enzyme encoded by this gene belongs to the aldehyde dehydrogenase family of enzymes that catalyze the chemical transformation from acetaldehyde to acetic acid. Aldehyde dehydrogenase is the second enzyme of the major oxidative pathway of alcohol metabolism. Hsu et al. (1985) assigned the ALDH2 locus to chromosome 12 by means of a cDNA probe and Southern blot analysis of somatic cell hybrids. Using an unbiased proteomic search, Chen et al. (2008) identified mitochondrial ALDH2 as an enzyme whose activation correlated with reduced ischemic heart damage in rodent models. A high-throughput screen identified a small molecule activator of ALDH2, which they called Alda-1, that, when administered to rats before an ischemic event, reduced infarct size by 60%, most likely through its inhibitory effect on the formation of cytotoxic aldehydes. Protein function: Required for clearance of cellular formaldehyde, a cytotoxic and carcinogenic metabolite that induces DNA damage. [The UniProt Consortium]
Schlagworte: Anti-ALDM, Anti-ALDH2, Anti-ALDHI, Anti-ALDH-E2, EC=1.2.1.3, Anti-ALDH class 2, Anti-Aldehyde dehydrogenase, mitochondrial, ALDH2 Antibody
Hersteller: NSJ Bioreagents
Hersteller-Nr: RQ5544

Eigenschaften

Anwendung: WB, FC, IF
Antikörper-Typ: Monoclonal
Klon: 5G7
Konjugat: No
Wirt: Mouse
Spezies-Reaktivität: human, mouse, rat
Immunogen: Amino acids SAAATQAVPAPNQQPEVFCNQIFINNEWHDA
Format: Purified

Handhabung & Sicherheit

Lagerung: +4°C
Versand: +4°C (International: +4°C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-ALDH2, clone 5G7"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen