Anti-ALDH1B1

Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
NSJ-R32505 100 µg - -

3 - 10 Werktage*

755,00 €
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Aldehyde dehydrogenase X, mitochondrial is... mehr
Produktinformationen "Anti-ALDH1B1"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Aldehyde dehydrogenase X, mitochondrial is an enzyme that in humans is encoded by the ALDH1B1 gene. This protein belongs to the aldehyde dehydrogenases family of proteins. Aldehyde dehydrogenase is the second enzyme of the major oxidative pathway of alcohol metabolism. This gene does not contain introns in the coding sequence. The variation of this locus may affect the development of alcohol-related problems. Protein function: ALDHs play a major role in the detoxification of alcohol- derived acetaldehyde. They are involved in the metabolism of corticosteroids, biogenic amines, neurotransmitters, and lipid peroxidation. [The UniProt Consortium]
Schlagworte: Anti-ALDH5, Anti-ALDH1B1, EC=1.2.1.3, Anti-Aldehyde dehydrogenase 5, Anti-Aldehyde dehydrogenase X, mitochondrial, Anti-Aldehyde dehydrogenase family 1 member B1, ALDH1B1 Antibody
Hersteller: NSJ Bioreagents
Hersteller-Nr: R32505

Eigenschaften

Anwendung: WB, IHC (paraffin), IF, FC
Antikörper-Typ: Polyclonal
Konjugat: No
Wirt: Rabbit
Spezies-Reaktivität: human, mouse, rat, monkey
Immunogen: Amino acids 116-156 (RVYLASLETLDNGKPFQESYALDLDEVIKVYRYFAGWADKW from the human protein
Format: Purified

Handhabung & Sicherheit

Lagerung: +4°C
Versand: +4°C (International: +4°C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-ALDH1B1"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Anti-ALDH1B1 Anti-ALDH1B1
755,00 €
-30 %
Rabattaktion
Anti-ALDH1B1 Anti-ALDH1B1
662,00 € 463,40 €
-30 %
Rabattaktion
Anti-ALDH1B1, Internal Anti-ALDH1B1, Internal
784,00 € 548,80 €
Zuletzt angesehen