Anti-ADSL / Adenylosuccinate Lyase

Anti-ADSL / Adenylosuccinate Lyase
Anti-ADSL / Adenylosuccinate Lyase
Anti-ADSL / Adenylosuccinate Lyase
     
%
Rabattaktion
Aktion:

Sichern Sie sich 30% Rabatt auf alle Primärantikörper von Arigo Biolaboratories!

*1
*1 Angebot gültig bis zum 16.12.2024
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Rabatt Preis
ARG58295.50 50 µg - -

6 - 14 Werktage*

30 %
520,00 €
364,00 €
 
This gene encodes a member of the lyase 1 family. The encoded protein forms a cytosolic... mehr
Produktinformationen "Anti-ADSL / Adenylosuccinate Lyase"
This gene encodes a member of the lyase 1 family. The encoded protein forms a cytosolic homotetramer and primarily catalyzes the reversible hydrolytic cleavage of argininosuccinate into arginine and fumarate, an essential step in the liver in detoxifying ammonia via the urea cycle. Mutations in this gene result in the autosomal recessive disorder argininosuccinic aciduria, or argininosuccinic acid lyase deficiency. A nontranscribed pseudogene is also located on the long arm of chromosome 22. Alternatively spliced transcript variants encoding different isoforms have been described. [provided by RefSeq, Jul 2008]
Schlagworte: Anti-ASL, Anti-ASAL, EC=4.3.2.1, Anti-Arginosuccinase, Anti-Argininosuccinate lyase
Hersteller: Arigo Biolaboratories
Hersteller-Nr: ARG58295

Eigenschaften

Anwendung: IHC (paraffin), WB
Antikörper-Typ: Polyclonal
Konjugat: No
Wirt: Rabbit
Spezies-Reaktivität: human, mouse, rat
Immunogen: Synthetic peptide corresponding to a sequence of Human Adenylosuccinate Lyase (YTHLQRAQPIRWSHWILSHAVALTRDSERLLEVRKRIN)
MW: 52 kD
Format: Antigen Affinity Purified

Handhabung & Sicherheit

Lagerung: -20°C
Versand: +4°C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-ADSL / Adenylosuccinate Lyase"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen