Anti-ACAA2

Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
NSJ-R32490 100 µg - -

3 - 10 Werktage*

772,00 €
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. 3-Ketoacyl-CoA thiolase, mitochondrial,... mehr
Produktinformationen "Anti-ACAA2"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. 3-Ketoacyl-CoA thiolase, mitochondrial, also known as acetyl-Coenzyme A acyltransferase 2, is an acetyl-CoA C-acyltransferase enzyme that in humans is encoded by the ACAA2 gene. The ACAA2 gene encodes a 41.9 kDa protein that is composed of 397 amino acids and contains 88 observed peptides. The encoded protein catalyzes the last step of themitochondrial fatty acid beta oxidation spiral. Unlike most mitochondrial matrix proteins, it contains a non-cleavable amino-terminal targeting signal. Additionally, ACAA2 has been shown to be a functional BNIP3 binding partner, which provides a possible link between fatty acid metabolism and cell apoptosis. Protein function: Abolishes BNIP3-mediated apoptosis and mitochondrial damage. [The UniProt Consortium]
Schlagworte: Anti-T1, Anti-ACAA2, EC=2.3.1.16, Anti-Beta-ketothiolase, Anti-Acetyl-CoA acyltransferase, Anti-Mitochondrial 3-oxoacyl-CoA thiolase, Anti-3-ketoacyl-CoA thiolase, mitochondrial, ACAA2 Antibody
Hersteller: NSJ Bioreagents
Hersteller-Nr: R32490

Eigenschaften

Anwendung: WB, IHC (paraffin), IF/ICC, FC
Antikörper-Typ: Polyclonal
Konjugat: No
Wirt: Rabbit
Spezies-Reaktivität: human, mouse, rat
Immunogen: Amino acids 207-242 (EVKTKKGKQTMQVDEHARPQTTLEQLQKLPPVFKKD from the human protein
Format: Purified

Handhabung & Sicherheit

Lagerung: +4°C
Versand: +4°C (International: +4°C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-ACAA2"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen